Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIonotropic glutamate receptor NMDA 1/2D
LigandBDBM50000109
Substrate/Competitorn/a
Meas. Tech.ChEMBL_140855
IC50 90900.0±n/a nM
Citation Johnson, GDrummond, JTBoxer, PABruns, RF Beta-proline analogues as agonists at the strychnine-sensitive glycine receptor. J Med Chem35:233-41 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ionotropic glutamate receptor NMDA 1/2D
Name:Ionotropic glutamate receptor NMDA1/2A/2B
Synonyms:Glutamate (NMDA) receptor subunit zeta 1 | Glutamate [NMDA] receptor subunit zeta-1 | Glutamate-NMDA-Channel | Glutamate-NMDA-MK801 | Glutamate-NMDA-Polyamine | NMDA | phencyclidine
Type:Enzyme Catalytic Domain
Mol. Mass.:105533.40
Organism:RAT
Description:P35439
Residue:938
Sequence:
MSTMHLLTFALLFSCSFARAACDPKIVNIGAVLSTRKHEQMFREAVNQANKRHGSWKIQL
NATSVTHKPNAIQMALSVCEDLISSQVYAILVSHPPTPNDHFTPTPVSYTAGFYRIPVLG
LTTRMSIYSDKSIHLSFLRTVPPYSHQSSVWFEMMRVYNWNHIILLVSDDHEGRAAQKRL
ETLLEERESKAEKVLQFDPGTKNVTALLMEARELEARVIILSASEDDAATVYRAAAMLNM
TGSGYVWLVGEREISGNALRYAPDGIIGLQLINGKNESAHISDAVGVVAQAVHELLEKEN
ITDPPRGCVGNTNIWKTGPLFKRVLMSSKYADGVTGRVEFNEDGDRKFANYSIMNLQNRK
LVQVGIYNGTHVIPNDRKIIWPGGETEKPRGYQMSTRLKIVTIHQEPFVYVKPTMSDGTC
KEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVA
DGKFGTQERVNNSNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTI
LVKKEIPRSTLDSFMQPFQSTLWLLVGLSVHVVAVMLYLLDRFSPFGRFKVNSEEEEEDA
LTLSSAMWFSWGVLLNSGIGEGAPRSFSARILGMVWAGFAMIIVASYTANLAAFLVLDRP
EERITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQA
VRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSH
ENGFMEDLDKTWVRYQECDSRSNAPATLTFENMAGVFMLVAGGIVAGIFLIFIEIAYKRH
KDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDT
STGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50000109
NameBDBM50000109
Synonyms:(2R)-2-aminopropanoic acid | (R)-2-aminopropanoic acid | (R)-alanine | CHEMBL66693 | D-Alanin | D-alanine | D-alpha-alanine | D-alpha-aminopropionic acid
TypeSmall organic molecule
Emp. Form.C3H7NO2
Mol. Mass.89.0932
SMILESC[C@@H](N)C(O)=O |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a