Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetChitinase 1
LigandBDBM50243800
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1672912
IC50 945±n/a nM
Citation Mazur, MOlczak, JOlejniczak, SKoralewski, RCzestkowski, WJedrzejczak, AGolab, JDzwonek, KDymek, BSklepkiewicz, PLZagozdzon, ANoonan, TMahboubi, KConway, BSheeler, RBeckett, PHungerford, WMPodjarny, AMitschler, ACousido-Siah, AFadel, FGolebiowski, A Targeting Acidic Mammalian chitinase Is Effective in Animal Model of Asthma. J Med Chem61:695-710 (2018) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Chitinase 1
Name:Chitinase 1
Synonyms:Chitinase-1 | Chitotriosidase | Chitotriosidase-1 | Chitotriosidase-1 (CHIT1)
Type:Enzyme
Mol. Mass.:51682.25
Organism:Homo sapiens (Human)
Description:Q13231
Residue:466
Sequence:
MVRSVAWAGFMVLLMIPWGSAAKLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAG
MTNHQLSTTEWNDETLYQEFNGLKKMNPKLKTLLAIGGWNFGTQKFTDMVATANNRQTFV
NSAIRFLRKYSFDGLDLDWEYPGSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLL
SAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAAS
LNVDAAVQQWLQKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGM
LAYYEVCSWKGATKQRIQDQKVPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWAL
DLDDFAGFSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTFC
QGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTWN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50243800
NameBDBM50243800
Synonyms:CHEMBL4075848
TypeSmall organic molecule
Emp. Form.C18H27ClN6
Mol. Mass.362.9
SMILESCC(C)N(CCc1ccc(Cl)cc1)C1CCN(CC1)c1nc(N)n[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a