Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMuscarinic acetylcholine receptor
LigandBDBM50004656
Substrate/Competitorn/a
Meas. Tech.ChEMBL_139898
Ki 8±n/a nM
Citation Valli, MJTang, YKosh, JWChapman, JMSowell, JW Synthesis and cholinergic properties of N-aryl-2-[[[5-[(dimethylamino)methyl]-2-furanyl]methyl]thio]ethylamino analogs of ranitidine. J Med Chem35:3141-7 (1992) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Muscarinic acetylcholine receptor
Name:Muscarinic acetylcholine receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:51515.43
Organism:Mus musculus
Description:ChEMBL_139897
Residue:466
Sequence:
MNNSTNSSNNGLAITSPYKTFEVVFIVLVAGSLSLVTIIGNILVMVSIKVNRHLQTVNNY
FLFSLACADLIIGVFSMNLYTLYTVIGYWPLGPVVCDLWLALDYVVSNASVMNLLIISFD
RYFCVTKPLTYPVKRTTKMAGMMIAAAWVLSFILWAPAILFWQFIVGVRTVEDGECYIQF
FSNAAVTFGTAIAAFYLPVIIMTVLYWHISRASKSRIKKEKKEPVANQDPVSPSLVQGRI
VKPNNNNMPGGDGGLEHNKIQNGKAPRDGGTENCVQGEEKESSNDSTSVSAVASNMRDDE
ITQDENTVSTSLGHSKDDNSRQTCIKIVTKTQKGDACTPTSTTVELVGSSGQNGDEKQNI
VARKIVKMTKQPAKKKPPPSREKKVTRTILAILLAFIITWAPYNVMVLINTFCAPCIPNT
VWTIGYWLCYINSTINPACYALCNATFKKTFKHLLMCHYKNIGATR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50004656
NameBDBM50004656
Synonyms:(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | (2-Carbamoyloxyethyl)trimethylammonium chloride | (2-Hydroxyethyl)trimethyl ammonium chloride carbamate | (2-Hydroxyethyl)trimethylammonium chloride carbamate | (carbachol)(2-Carbamoyloxy-ethyl)-trimethyl-ammonium | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminium chloride | 2-((Aminocarbonyl)oxy)-N,N,N-trimethylethanaminum chloride | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium | 2-(carbamoyloxy)-N,N,N-trimethylethanaminium chloride | CARBACHOL | CARBASTAT | CHEMBL14 | Carbachol chloride | Carbamylcholine | Choline carbamate chloride | Choline chloride, carbamate | Choline chlorine carbamate | Karbachol | Karbamoylcholin chlorid | MIOSTAT
TypeSmall organic molecule
Emp. Form.C6H15N2O2
Mol. Mass.147.195
SMILESC[N+](C)(C)CCOC(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a