Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBromodomain-containing protein 9
LigandBDBM50249787
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1680633
IC50 170±n/a nM
Citation Igoe, NBayle, EDTallant, CFedorov, OMeier, JCSavitsky, PRogers, CMorias, YScholze, SBoyd, HCunoosamy, DAndrews, DMCheasty, ABrennan, PEMüller, SKnapp, SFish, PV Design of a Chemical Probe for the Bromodomain and Plant Homeodomain Finger-Containing (BRPF) Family of Proteins. J Med Chem60:6998-7011 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Bromodomain-containing protein 9
Name:Bromodomain-containing protein 9
Synonyms:BRD9 | Bromodomain-containing protein 9 | Rhabdomyosarcoma antigen MU-RMS-40.8
Type:PROTEIN
Mol. Mass.:66994.30
Organism:Homo sapiens (Human)
Description:ChEMBL_108000
Residue:597
Sequence:
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50249787
NameBDBM50249787
Synonyms:CHEMBL4103077
TypeSmall organic molecule
Emp. Form.C20H19N3O5S
Mol. Mass.413.447
SMILESCOc1cc2n(C)c(=O)c(C)cc2cc1NS(=O)(=O)c1ccc(cc1OC)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a