Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCyclic GMP-AMP synthase
LigandBDBM50250110
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1680904
IC50 78000±n/a nM
Citation Hall, JBrault, AVincent, FWeng, SWang, HDumlao, DAulabaugh, AAivazian, DCastro, DChen, MCulp, JDower, KGardner, JHawrylik, SGolenbock, DHepworth, DHorn, MJones, LJones, PLatz, ELi, JLin, LLLin, WLin, DLovering, FNiljanskul, NNistler, RPierce, BPlotnikova, OSchmitt, DShanker, SSmith, JSnyder, WSubashi, TTrujillo, JTyminski, EWang, GWong, JLefker, BDakin, LLeach, K Discovery of PF-06928215 as a high affinity inhibitor of cGAS enabled by a novel fluorescence polarization assay. PLoS ONE12:1-16 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cyclic GMP-AMP synthase
Name:Cyclic GMP-AMP synthase
Synonyms:2''3''-cGAMP synthase | 2.7.7.86 | CGAS | Cyclic GMP-AMP synthase | MB21D1 | Mab-21 domain-containing protein 1 | Synonyms=C6orf150 | cGAMP synthase | cGAS | h-cGAS
Type:PROTEIN
Mol. Mass.:58845.55
Organism:Homo sapiens
Description:ChEMBL_117333
Residue:522
Sequence:
MQPWHGKAMQRASEAGATAPKASARNARGAPMDPTESPAAPEAALPKAGKFGPARKSGSR
QKKSAPDTQERPPVRATGARAKKAPQRAQDTQPSDATSAPGAEGLEPPAAREPALSRAGS
CRQRGARCSTKPRPPPGPWDVPSPGLPVSAPILVRRDAAPGASKLRAVLEKLKLSRDDIS
TAAGMVKGVVDHLLLRLKCDSAFRGVGLLNTGSYYEHVKISAPNEFDVMFKLEVPRIQLE
EYSNTRAYYFVKFKRNPKENPLSQFLEGEILSASKMLSKFRKIIKEEINDIKDTDVIMKR
KRGGSPAVTLLISEKISVDITLALESKSSWPASTQEGLRIQNWLSAKVRKQLRLKPFYLV
PKHAKEGNGFQEETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQL
KERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKL
ENYFIPEFNLFSSNLIDKRSKEFLTKQIEYERNNEFPVFDEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50250110
NameBDBM50250110
Synonyms:CHEMBL4065757
TypeSmall organic molecule
Emp. Form.C10H7N5O
Mol. Mass.213.1955
SMILESOc1cc(nc2nnnn12)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a