Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD(4) dopamine receptor
LigandBDBM21397
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1682172
Ki 0.450000±n/a nM
Citation Reilly, SWGriffin, STaylor, MSahlholm, KWeng, CCXu, KJacome, DALuedtke, RRMach, RH Highly Selective Dopamine D J Med Chem60:9905-9910 (2017) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
D(4) dopamine receptor
Name:D(4) dopamine receptor
Synonyms:D(2C) dopamine receptor | DOPAMINE D4 | DOPAMINE D4.2 | DOPAMINE D4.4 | DRD4 | Dopamine D4 receptor
Type:Enzyme
Mol. Mass.:48373.19
Organism:Homo sapiens (Human)
Description:P21917
Residue:419
Sequence:
MGNRSTADADGLLAGRGPAAGASAGASAGLAGQGAAALVGGVLLIGAVLAGNSLVCVSVA
TERALQTPTNSFIVSLAAADLLLALLVLPLFVYSEVQGGAWLLSPRLCDALMAMDVMLCT
ASIFNLCAISVDRFVAVAVPLRYNRQGGSRRQLLLIGATWLLSAAVAAPVLCGLNDVRGR
DPAVCRLEDRDYVVYSSVCSFFLPCPLMLLLYWATFRGLQRWEVARRAKLHGRAPRRPSG
PGPPSPTPPAPRLPQDPCGPDCAPPAPGLPRGPCGPDCAPAAPSLPQDPCGPDCAPPAPG
LPPDPCGSNCAPPDAVRAAALPPQTPPQTRRRRRAKITGRERKAMRVLPVVVGAFLLCWT
PFFVVHITQALCPACSVPPRLVSAVTWLGYVNSALNPVIYTVFNAEFRNVFRKALRACC
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM21397
NameBDBM21397
Synonyms:8-[4-(4-fluorophenyl)-4-keto-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxidanylidene-butyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | 8-[4-(4-fluorophenyl)-4-oxobutyl]-1-phenyl-1,3,8-triazaspiro[4.5]decan-4-one | CHEMBL267930 | MLS000028615 | SMR000058674 | SPIPERONE | Spiroperidol | US9359372, Spiperone | [3H]-Spiroperidol | cid_5265
Typeradiolabeled ligand
Emp. Form.C23H26FN3O2
Mol. Mass.395.4698
SMILESFc1ccc(cc1)C(=O)CCCN1CCC2(CC1)N(CNC2=O)c1ccccc1
Structure
n/a