Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeurokinin 1 receptor
LigandBDBM50007822
Substrate/Competitorn/a
Meas. Tech.ChEMBL_141637
EC50 892±n/a nM
Citation Ward, PEwan, GBJordan, CCIreland, SJHagan, RMBrown, JR Potent and highly selective neurokinin antagonists. J Med Chem33:1848-51 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neurokinin 1 receptor
Name:Neurokinin 1 receptor
Synonyms:Neurokinin NK1
Type:Enzyme Catalytic Domain
Mol. Mass.:46261.42
Organism:GUINEA PIG
Description:Neurokinin NK1 TACR1 GUINEA PIG::P30547
Residue:407
Sequence:
MDNVLPVDSDLFPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPGRVVC
MIEWPSHPDKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAADYEGLEMKSTRYFQTQGSVYKVSRLETTIST
VVGAHEEDPEEGPKATPSSLDLTSNGSSRSNSKTVTESSSFYSNMLS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50007822
NameBDBM50007822
Synonyms:2-(2-{2-[2-(4-Amino-butyrylamino)-3-phenyl-propionylamino]-3-phenyl-propionylamino}-acetylamino)-4-methyl-pentanoic acid [1-carbamoyl-2-(1H-indol-3-yl)-ethyl]-amide | CHEMBL2372954
TypeSmall organic molecule
Emp. Form.C41H52N8O6
Mol. Mass.752.9016
SMILESCC(C)C[C@H](NC(=O)CNC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccccc1)NC(=O)CCCN)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(N)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a