Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase
LigandBDBM16452
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31930
IC50 41±n/a nM
Citation Mylari, BLLarson, ERBeyer, TAZembrowski, WJAldinger, CEDee, MFSiegel, TWSingleton, DH Novel, potent aldose reductase inhibitors: 3,4-dihydro-4-oxo-3-[[5-(trifluoromethyl)-2-benzothiazolyl] methyl]-1-phthalazineacetic acid (zopolrestat) and congeners. J Med Chem34:108-22 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase
Name:Aldose reductase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:35797.87
Organism:Rattus norvegicus
Description:ChEMBL_1512484
Residue:316
Sequence:
MASHLELNNGTKMPTLGLGTWKSPPGQVTEAVKVAIDMGYRHIDCAQVYQNEKEVGVALQ
EKLKEQVVKRQDLFIVSKLWCTFHDQSMVKGACQKTLSDLQLDYLDLYLIHWPTGFKPGP
DYFPLDASGNVIPSDTDFVDTWTAMEQLVDEGLVKAIGVSNFNPLQIERILNKPGLKYKP
AVNQIECHPYLTQEKLIEYCHCKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKEIAAK
YNKTTAQVLIRFPIQRNLVVIPKSVTPARIAENFKVFDFELSNEDMATLLSYNRNWRVCA
LMSCAKHKDYPFHAEV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16452
NameBDBM16452
Synonyms:(4-oxo-3-{[5-(trifluoromethyl)-1,3-benzothiazol-2-yl]methyl}-3,4-dihydrophthalazin-1-yl)acetic acid | 2-(4-oxo-3-{[5-(trifluoromethyl)-1,3-benzothiazol-2-yl]methyl}-3,4-dihydrophthalazin-1-yl)acetic acid | Alond | CHEMBL10372 | Xedia | Zopolrestat
TypeSmall organic molecule
Emp. Form.C19H12F3N3O3S
Mol. Mass.419.377
SMILESOC(=O)Cc1nn(Cc2nc3cc(ccc3s2)C(F)(F)F)c(=O)c2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a