Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAngiotensin II AT1B
LigandBDBM50010148
Substrate/Competitorn/a
Meas. Tech.ChEBML_36482
IC50 5400±n/a nM
Citation Bühlmayer, PCriscione, LFuhrer, WFuret, Pde Gasparo, MStutz, SWhitebread, S Nonpeptidic angiotensin II antagonists: synthesis and in vitro activity of a series of novel naphthalene and tetrahydronaphthalene derivatives. J Med Chem34:3105-14 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Angiotensin II AT1B
Name:Angiotensin II receptor (AT-1) type-1
Synonyms:AT1B | AT3 | Angiotensin II receptor (AT-1) type-1 | Angiotensin II type 1b (AT-1b) receptor | Type-1B angiotensin II receptor
Type:Enzyme Catalytic Domain
Mol. Mass.:40929.44
Organism:RAT
Description:Angiotensin II AT1B 0 RAT::P29089
Residue:359
Sequence:
MTLNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNHLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLMAGLASLPAVIYRNVYFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFVFPFLIILTSYTLIWKALKKAYKIQKNTPRNDDIFR
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIRDCEIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPTAKSHAGLSTKMSTLSYRPSDNMSSSAKKSASFFEVE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50010148
NameBDBM50010148
Synonyms:CHEMBL106934 | {2-Butyl-5-chloro-3-[6-(1H-tetrazol-5-yl)-5,6,7,8-tetrahydro-naphthalen-2-ylmethyl]-3H-imidazol-4-yl}-methanol
TypeSmall organic molecule
Emp. Form.C20H25ClN6O
Mol. Mass.400.905
SMILESCCCCc1nc(Cl)c(CO)n1Cc1ccc2CC(CCc2c1)c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a