Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC5a anaphylatoxin chemotactic receptor (C5aR)
LigandBDBM50012292
Substrate/Competitorn/a
Meas. Tech.ChEBML_41599
Ki 50000±n/a nM
Citation Kawai, MQuincy, DALane, BMollison, KWLuly, JRCarter, GW Identification and synthesis of a receptor binding site of human anaphylatoxin C5a. J Med Chem34:2068-71 (1991) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C5a anaphylatoxin chemotactic receptor (C5aR)
Name:C5a anaphylatoxin chemotactic receptor
Synonyms:C5a anaphylatoxin chemotactic receptor | C5a-R | C5aR | CD_antigen=CD88
Type:Enzyme
Mol. Mass.:39347.68
Organism:Homo sapiens (Human)
Description:P21730
Residue:350
Sequence:
MDSFNYTTPDYGHYDDKDTLDLNTPVDKTSNTLRVPDILALVIFAVVFLVGVLGNALVVW
VTAFEAKRTINAIWFLNLAVADFLSCLALPILFTSIVQHHHWPFGGAACSILPSLILLNM
YASILLLATISADRFLLVFKPIWCQNFRGAGLAWIACAVAWGLALLLTIPSFLYRVVREE
YFPPKVLCGVDYSHDKRRERAVAIVRLVLGFLWPLLTLTICYTFILLRTWSRRATRSTKT
LKVVVAVVASFFIFWLPYQVTGIMMSFLEPSSPTFLLLKKLDSLCVSFAYINCCINPIIY
VVAGQGFQGRLRKSLPSLLRNVLTEESVVRESKSFTRSTVDTMAQKTQAV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50012292
NameBDBM50012292
Synonyms:AcMet-Val-Val-Ala-Ser-Gln-Leu-Arg-Ala-Asn-Ile-Ser-His-Lys-Asp-Met-Gln-Leu-Gly-Arg | CHEMBL414570
TypeSmall organic molecule
Emp. Form.C96H166N32O29S2
Mol. Mass.2296.672
SMILESCC[C@H](C)[C@H](NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CCSC)NC(C)=O)C(C)C)C(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a