Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldose reductase (ALR2)
LigandBDBM16314
Substrate/Competitorn/a
Meas. Tech.ChEBML_31342
IC50 35±n/a nM
Citation Ellingboe, JAlessi, TMillen, JSredy, JKing, APrusiewicz, CGuzzo, FVanEngen, DBagli, J (Pyrimidinyloxy)acetic acids and pyrimidineacetic acids as a novel class of aldose reductase inhibitors. J Med Chem33:2892-9 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Aldose reductase (ALR2)
Name:Aldose reductase
Synonyms:Aldose reductase
Type:Protein
Mol. Mass.:35916.27
Organism:Bos taurus (Cattle)
Description:n/a
Residue:315
Sequence:
AHNIVLYTGAKMPILGLGTWKSPPGKVTEAVKVAIDLGYRHIDCAHVYQNENEVGLALQA
KLQEQVVKREDLFIVSKLWCTYHDKDLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKD
FFPLDEDGNVIPSEKDFVDTWTAMEELVDEGLVKAIGVSNFNHLQVEKILNKPGLKYKPA
VNQIECHPYLTQEKLIQYCNSKGIVVTAYSPLGSPDRPWAKPEDPSILEDPRIKAIADKY
NKTTAQVLIRFPIQRNLIVIPKSVTPERIAENFQVFDFELDKEDMNTLLSYNRDWRACAL
VSCASHRDYPFHEEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16314
NameBDBM16314
Synonyms:2-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]-N-methylmethanethioamido}acetic acid | Alredase | CHEMBL436 | N-{[6-methoxy-5-(trifluoromethyl)naphthalen-1-yl]carbonothioyl}-N-methylglycine | Tolrestat
TypeSmall organic molecule
Emp. Form.C16H14F3NO3S
Mol. Mass.357.347
SMILESCOc1ccc2c(cccc2c1C(F)(F)F)C(=S)N(C)CC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a