Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetOxytocin receptor
LigandBDBM50013635
Substrate/Competitorn/a
Meas. Tech.ChEMBL_149182
Ki 1.6±n/a nM
Citation Freidinger, RMWilliams, PDTung, RDBock, MGPettibone, DJClineschmidt, BVDiPardo, RMErb, JMGarsky, VMGould, NP Cyclic hexapeptide oxytocin antagonists. Potency-, selectivity-, and solubility-enhancing modifications. J Med Chem33:1843-5 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Oxytocin receptor
Name:Oxytocin receptor
Synonyms:OT-R | Oxytocin
Type:Enzyme Catalytic Domain
Mol. Mass.:42889.28
Organism:RAT
Description:Oxytocin OXTR RAT::P70536
Residue:388
Sequence:
MEGTPAANWSVELDLGSGVPPGEEGNRTAGPPQRNEALARVEVAVLCLILFLALSGNACV
LLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQV
VGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVLGTWLGCLVASAPQVHIFSLREV
ADGVFDCWAVFIQPWGPKAYVTWITLAVYIVPVIVLAACYGLISFKIWQNLRLKTAAAAA
AAEGNDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD
VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQRFFCCSARYLKGSRPGETS
VSKKSNSSTFVLSRRSSSQRSCSQPSSA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50013635
NameBDBM50013635
Synonyms:24-(1H-5-imidazolylmethyl)-13-[1-methyl-(1S)-propyl]-16-(2-naphthylmethyl)perhydrodipyrido[1,2-a:1,2-d]pyrrolo[1,2-j][1,4,7,10,13,16]hexaazacyclooctadecine-6,12,15,18,23,26-hexaone | CHEMBL2372927
TypeSmall organic molecule
Emp. Form.C42H54N8O6
Mol. Mass.766.9282
SMILES[H][C@]12CCCN1C(=O)[C@H](Cc1c[nH]cn1)NC(=O)[C@@]1([H])CCCCN1C(=O)[C@]1([H])CCCCN1C(=O)[C@@]([H])(NC(=O)[C@H](Cc1ccc3ccccc3c1)NC2=O)[C@@H](C)CC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a