Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50014136
Substrate/Competitorn/a
Meas. Tech.ChEBML_196290
IC50 22000±n/a nM
Citation Dutta, ASGormley, JJMcLachlan, PFMajor, JS Inhibitors of human renin. Cyclic peptide analogues containing a D-Phe-Lys-D-Trp sequence. J Med Chem33:2560-8 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:44272.67
Organism:Rattus norvegicus
Description:ChEMBL_222765
Residue:402
Sequence:
MGGRRMPLWALLLLWTSCSFSLPTDTASFGRILLKKMPSVREILEERGVDMTRISAEWGE
FIKKSSFTNVTSPVVLTNYLDTQYYGEIGIGTPSQTFKVIFDTGSANLWVPSTKCGPLYT
ACEIHNLYDSSESSSYMENGTEFTIHYGSGKVKGFLSQDVVTVGGIIVTQTFGEVTELPL
IPFMLAKFDGVLGMGFPAQAVDGVIPVFDHILSQRVLKEEVFSVYYSRESHLLGGEVVLG
GSDPQHYQGNFHYVSISKAGSWQITMKGVSVGPATLLCEEGCMAVVDTGTSYISGPTSSL
QLIMQALGVKEKRANNYVVNCSQVPTLPDISFYLGGRTYTLSNMDYVQKNPFRNDDLCIL
ALQGLDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014136
NameBDBM50014136
Synonyms:6-Amino-2-(3-benzyl-2,5,9-trioxo-[1,4]diazonan-1-yl)-hexanoic acid [2-(1H-indol-3-yl)-1-(2-methyl-butylcarbamoyl)-ethyl]-amide | CHEMBL314065
TypeSmall organic molecule
Emp. Form.C36H48N6O5
Mol. Mass.644.8035
SMILESCCC(C)CNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)N1C(=O)CCCC(=O)N[C@@H](Cc2ccccc2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a