Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRenin
LigandBDBM50014137
Substrate/Competitorn/a
Meas. Tech.ChEBML_195951
IC50 430.0±n/a nM
Citation Dutta, ASGormley, JJMcLachlan, PFMajor, JS Inhibitors of human renin. Cyclic peptide analogues containing a D-Phe-Lys-D-Trp sequence. J Med Chem33:2560-8 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Renin
Name:Renin
Synonyms:Angiotensinogenase
Type:Enzyme
Mol. Mass.:45058.99
Organism:Homo sapiens (Human)
Description:n/a
Residue:406
Sequence:
MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEW
SQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRL
YTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEM
PALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGG
QIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISG
STSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKK
LCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014137
NameBDBM50014137
Synonyms:6-Amino-2-(3-benzyl-8-isobutyl-2,5,9-trioxo-[1,4,7]triazonan-1-yl)-hexanoic acid [2-(1H-indol-3-yl)-1-(3-methyl-butylcarbamoyl)-ethyl]-amide | CHEMBL2370009
TypeSmall organic molecule
Emp. Form.C39H55N7O5
Mol. Mass.701.8979
SMILESCC(C)CCNC(=O)[C@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](CCCCN)N1C(=O)[C@H](CC(C)C)NCC(=O)N[C@@H](Cc2ccccc2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a