Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAICAR transformylase
LigandBDBM50014707
Substrate/Competitorn/a
Meas. Tech.ChEBML_28412
IC50>50000±n/a nM
Citation DeGraw, JIChristie, PHKisliuk, RLGaumont, YSirotnak, FM Synthesis and antifolate properties of 9-alkyl-10-deazaminopterins. J Med Chem33:212-5 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
AICAR transformylase
Name:AICAR transformylase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:64218.64
Organism:Mus musculus
Description:ChEMBL_28425
Residue:592
Sequence:
MAPSQLALFSVSDKTGLVEFARSLASLGLSLVASGGTAKAIRDAGLAVRDVSELTGFPEM
LGGRVKTLHPAVHAGILARNIPEDAADMARLDFNLVRVVVCNLYPFVKTVASPDVTVEAA
VEQIDIGGVTLLRAAAKNHARVTVVCEPEDYAGVAAEMHGSDSKDTSLETRRHLALKAFT
HTAQYDEAISDYFRKQYSKGISQMPLRYGMNPHQTPAQLYTLKPKLPITVLNGAPGFINL
CDALNAWQLVTELRGAVDIPAAASFKHVSPAGAAVGVPLSEDEARVCMVYDLYPTLTPLA
VAYARARGADRMSSFGDFVALSDICDVPTAKIISREVSDGIVAPGYEEEALKILSKKKNG
NYCVLQMDQSYKPDENEVRTLFGLRLSQKRNNGVVDKSLFSNIVTKNKDLPESALRDLIV
ATVAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKA
GVKRAEISNAIDQYVTGTIGEGEDLVKWEALFEEVPELLTEAEKKEWVDKLSGVSVSSDA
FFPFRDNVDRAKRSGVAYIVAPSGSTADKVVIEACDELGIVLAHTDLRLFHH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50014707
NameBDBM50014707
Synonyms:2-{4-[2-(2,4-Diamino-pteridin-6-yl)-propyl]-benzoylamino}-pentanedioic acid | CHEMBL431359
TypeSmall organic molecule
Emp. Form.C21H23N7O5
Mol. Mass.453.4512
SMILESCC(Cc1ccc(cc1)C(=O)NC(CCC(O)=O)C(O)=O)c1cnc2nc(N)nc(N)c2n1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a