Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50015710
Substrate/Competitorn/a
Meas. Tech.ChEBML_1768
IC50 21±n/a nM
Citation Macor, JEBurkhart, CAHeym, JHIves, JLLebel, LANewman, MENielsen, JARyan, KSchulz, DWTorgersen, LK 3-(1,2,5,6-Tetrahydropyrid-4-yl)pyrrolo[3,2-b]pyrid-5-one: a potent and selective serotonin (5-HT1B) agonist and rotationally restricted phenolic analogue of 5-methoxy-3-(1,2,5,6-tetrahydropyrid-4-yl)indole. J Med Chem33:2087-93 (1990) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50015710
NameBDBM50015710
Synonyms:4-Piperazin-1-yl-7-trifluoromethyl-pyrrolo[1,2-a]quinoxaline | 4-Piperazin-1-yl-7-trifluoromethyl-pyrrolo[1,2-a]quinoxaline(desmethyl-CGS-12066B) | CHEMBL28178
TypeSmall organic molecule
Emp. Form.C16H15F3N4
Mol. Mass.320.3123
SMILESFC(F)(F)c1ccc2c(c1)nc(N1CCNCC1)c1cccn21
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a