Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase
LigandBDBM50450973
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1744439
Ki 0.050000±n/a nM
Citation González-Bello, C Antibiotic adjuvants - A strategy to unlock bacterial resistance to antibiotics. Bioorg Med Chem Lett27:4221-4228 (2017) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase
Name:Beta-lactamase
Synonyms:3.5.2.6 | Beta-lactamase | ampC
Type:PROTEIN
Mol. Mass.:75487.24
Organism:Bacillus cereus
Description:ChEMBL_117771
Residue:676
Sequence:
MKQAINKLGIVAVLLSSSTMISACSQQLLEAEKSKPLASSTNIQMMEGPNNKKEIESFAD
PLFEEKMKKYNVNGSSFVVVHDGKVVVNKGYGYANKEKKIPVTKDTVFQIASVSKTFTAL
AVMQQVDKGKLKLDQDVQKYLGGLQIPNQTGKPLTLFDMLTYTSGVDFPDLTNITGPEYV
HNSIPMKEFFSKHMPTVIRPPGEVYTYDNVSFALAGFAVENATNTPFSKYMEKNIFKPLD
MESTSMSFTPDLLKRMATHYGPTGDPIPTSGSGLRDTPQGGILSTAEDMSKYMIMQLQKG
TFKDKEIISKKGIDMMHAYQVFDDKTVPVATIGFETPFNKFANDQHVVMKGGSMPGHQSL
LILVPEQKTAFFMSYNNDSMMSIDIYEALMDHYFPAKKNEVKTSYLPLEEKEAHKYLGLF
QNTRFAAIRTHFTYENGNLIMEGGTTGKQVLKMIHSLLFEDSEGNKVAFKKNSAGEITYF
HYTSPKSLDFVADAQKINNKSPFDDVPAKSKYRSHIDNLHALNIMGAKTDNLFNPMDTMT
QGEFADMLLLAHGWNGFPDESKEAREKMINGIPEYNRATPITRQVAATMIQNVKQIQDLK
PIRPDKAIKVKLLDAADDWAVQSIQALASQGILDPDTSINADGSFMFRPKDVLLRQEASS
LLDLAFGYYSLPIKRQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50450973
NameBDBM50450973
Synonyms:CHEMBL4209255
TypeSmall organic molecule
Emp. Form.C10H9BF3N5O5S
Mol. Mass.379.08
SMILESOB(O)CNC(=O)S(=O)(=O)c1cc(cc(c1)C(F)(F)F)-c1nnn[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a