Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine A2b receptor
LigandBDBM10849
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1754702
Ki 23000±n/a nM
Citation Köse, MGollos, SKarcz, TFiene, AHeisig, FBehrenswerth, AKie?-Kononowicz, KNamasivayam, VMüller, CE Fluorescent-Labeled Selective Adenosine A J Med Chem61:4301-4316 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Adenosine A2b receptor
Name:Adenosine A2b receptor
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:36130.09
Organism:Mus musculus
Description:ChEMBL_11831
Residue:332
Sequence:
MQLETQDALYVALELVIAALAVAGNVLVCAAVGASSALQTPTNYFLVSLATADVAVGLFA
IPFAITISLGFCTDFHGCLFLACFVLVLTQSSIFSLLAVAVDRYLAIRVPLRYKGLVTGT
RARGIIAVLWVLAFGIGLTPFLGWNSKDSATSNCTELGDGIANKSCCPVTCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFMVACKQLQRMELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAINCITLFHPALAKDKPKWVMNVAILLSHANSVVNPIVYAYRNRDFRYS
FHKIISRYVLCQAETKGGSGQAGAQSTLSLGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10849
NameBDBM10849
Synonyms:1,3,7-trimethyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | 1,3,7-trimethyl-3,7-dihydropurine-2,6-dione | CHEMBL113 | Caffeine (1,3,7-trimethylxanthine) | caffeine
TypeSmall organic molecule
Emp. Form.C8H10N4O2
Mol. Mass.194.1906
SMILESCn1cnc2n(C)c(=O)n(C)c(=O)c12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a