Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase III
LigandBDBM50022167
Substrate/Competitorn/a
Meas. Tech.ChEBML_54514
Ki 2000±n/a nM
Citation Trantolo, DJWright, GEBrown, NC Inhibitors of Bacillus subtilis DNA polymerase III. Influence of modifications in the pyrimidine ring of anilino- and (benzylamino)pyrimidines. J Med Chem29:676-81 (1986) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase III
Name:DNA topoisomerase III
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:81515.22
Organism:Bacillus subtilis
Description:ChEMBL_54525
Residue:727
Sequence:
MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHLVTLADPEGYGKEFQS
WRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIATDAGREGELVARWIIEK
ANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVARAEADWIVGINATRALTT
KFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVDGMTLTWQDKKSKQTRTFN
QDVTSRLLKNLQGKQAVVAELKKTAKKSFAPALYDLTELQRDAHKRFGFSAKETLSVLQK
LYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQYVSQIKKRGIKSHKGYVNDA
KVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGETFT
AKGKTVQSQGWKAVYDMAEEDDEQEDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFN
EGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVATRADIIEKLFNSFLIEKKGQDIFI
TSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKLKSAVFIKDMKAYAHQTVKEIKNSS
QTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQDRECGSRKTIARKTNARCPNCHKRME
LRGQGEGQTFACVCGHREKLSVFEKRKNKDKARATKRDVSSYMKKQNKDEPINNALAEQL
KKLGLDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50022167
NameBDBM50022167
Synonyms:2-Amino-6-(indan-5-ylamino)-3H-pyrimidin-4-one | CHEMBL349592
TypeSmall organic molecule
Emp. Form.C13H14N4O
Mol. Mass.242.2765
SMILESNc1nc(Nc2ccc3CCCc3c2)cc(=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a