Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAldehyde dehydrogenase family 1 member A3
LigandBDBM50459608
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1766746
Ki 261±n/a nM
Citation Huddle, BCGrimley, EBuchman, CDChtcherbinine, MDebnath, BMehta, PYang, KMorgan, CALi, SFelton, JSun, DMehta, GNeamati, NBuckanovich, RJHurley, TDLarsen, SD Structure-Based Optimization of a Novel Class of Aldehyde Dehydrogenase 1A (ALDH1A) Subfamily-Selective Inhibitors as Potential Adjuncts to Ovarian Cancer Chemotherapy. J Med Chem61:8754-8773 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Aldehyde dehydrogenase family 1 member A3
Name:Aldehyde dehydrogenase family 1 member A3
Synonyms:ALDH1A3 | ALDH6 | Aldehyde dehydrogenase 6 | Aldehyde dehydrogenase family 1 member A3 | RALDH-3 | RalDH3 | Retinaldehyde dehydrogenase 3
Type:PROTEIN
Mol. Mass.:56110.85
Organism:Homo sapiens (Human)
Description:ChEMBL_109700
Residue:512
Sequence:
MATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFINNEWHESKSGKKFATCNPSTREQI
CEVEEGDKPDVDKAVEAAQVAFQRGSPWRRLDALSRGRLLHQLADLVERDRATLAALETM
DTGKPFLHAFFIDLEGCIRTLRYFAGWADKIQGKTIPTDDNVVCFTRHEPIGVCGAITPW
NFPLLMLVWKLAPALCCGNTMVLKPAEQTPLTALYLGSLIKEAGFPPGVVNIVPGFGPTV
GAAISSHPQINKIAFTGSTEVGKLVKEAASRSNLKRVTLELGGKNPCIVCADADLDLAVE
CAHQGVFFNQGQCCTAASRVFVEEQVYSEFVRRSVEYAKKRPVGDPFDVKTEQGPQIDQK
QFDKILELIESGKKEGAKLECGGSAMEDKGLFIKPTVFSEVTDNMRIAKEEIFGPVQPIL
KFKSIEEVIKRANSTDYGLTAAVFTKNLDKALKLASALESGTVWINCYNALYAQAPFGGF
KMSGNGRELGEYALAEYTEVKTVTIKLGDKNP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50459608
NameBDBM50459608
Synonyms:CHEBI:90441 | CHEMBL3276621
TypeSmall organic molecule
Emp. Form.C12H20Cl4N2O2
Mol. Mass.366.111
SMILESClC(Cl)C(=O)NCCCCCCCCNC(=O)C(Cl)Cl
Structure
n/a