Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein kinase NEK2
LigandBDBM50463479
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1778404
Ki>2000±n/a nM
Citation Bandarage, UKCao, JCome, JHCourt, JJGao, HJacobs, MDMarhefka, CNanthakumar, SGreen, J ROCK inhibitors 3: Design, synthesis and structure-activity relationships of 7-azaindole-based Rho kinase (ROCK) inhibitors. Bioorg Med Chem Lett28:2622-2626 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein kinase NEK2
Name:Serine/threonine-protein kinase NEK2
Synonyms:NEK2
Type:Enzyme
Mol. Mass.:51776.96
Organism:Homo sapiens (Human)
Description:P51955
Residue:445
Sequence:
MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLR
ELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQL
TLALKECHRRSDGGHTVLHRDLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTP
YYMSPEQMNRMSYNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRY
SDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSS
PVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAENLLKNYSLLKE
RKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA
QLRAQALSDIEKNYQLKSRQILGMR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50463479
NameBDBM50463479
Synonyms:CHEMBL4249925
TypeSmall organic molecule
Emp. Form.C19H17N5O3S2
Mol. Mass.427.5
SMILESCS(=O)(=O)Nc1cccc(CC(=O)Nc2nc(cs2)-c2c[nH]c3ncccc23)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a