Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPoly [ADP-ribose] polymerase 15
LigandBDBM50452662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1800456
IC50 3300±n/a nM
Citation Murthy, SDesantis, JVerheugd, PMaksimainen, MMVenkannagari, HMassari, SAshok, YObaji, ENkizinkinko, YLüscher, BTabarrini, OLehtiö, L 4-(Phenoxy) and 4-(benzyloxy)benzamides as potent and selective inhibitors of mono-ADP-ribosyltransferase PARP10/ARTD10. Eur J Med Chem156:93-102 (2018) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Poly [ADP-ribose] polymerase 15
Name:Poly [ADP-ribose] polymerase 15
Synonyms:(ARTD7 or PARP15) | (ARTD7 or PARP15, Y598L) | 2.4.2.- | 2.4.2.30 | ADP-ribosyltransferase diphtheria toxin-like 7 | ARTD7 | B-aggressive lymphoma protein 3 | BAL3 | Human diphtheria toxin-like ADP-ribosyltransferase (ARTD7 or PARP15, Y598L) | PARP-15 | PARP15 | Protein mono-ADP-ribosyltransferase PARP15
Type:n/a
Mol. Mass.:74595.89
Organism:Homo sapiens (Human)
Description:Q460N3
Residue:678
Sequence:
MAAPGPLPAAALSPGAPTPRELMHGVAGVTSRAGRDREAGSVLPAGNRGARKASRRSSSR
SMSRDNKFSKKDCLSIRNVVASIQTKEGLNLKLISGDVLYIWADVIVNSVPMNLQLGGGP
LSRAFLQKAGPMLQKELDDRRRETEEKVGNIFMTSGCNLDCKAVLHAVAPYWNNGAETSW
QIMANIIKKCLTTVEVLSFSSITFPMIGTGSLQFPKAVFAKLILSEVFEYSSSTRPITSP
LQEVHFLVYTNDDEGCQAFLDEFTNWSRINPNKARIPMAGDTQGVVGTVSKPCFTAYEMK
IGAITFQVATGDIATEQVDVIVNSTARTFNRKSGVSRAILEGAGQAVESECAVLAAQPHR
DFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITV
ADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTC
NLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVK
KRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSA
KDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLF
VVFFDNQAYPEYLITFTA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50452662
NameBDBM50452662
Synonyms:CHEMBL4208737
TypeSmall organic molecule
Emp. Form.C14H12FNO2
Mol. Mass.245.249
SMILESNC(=O)c1ccc(OCc2ccccc2F)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a