Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor 1B
LigandBDBM50470044
Substrate/Competitorn/a
Meas. Tech.ChEMBL_200340
Kd 5.6±n/a nM
Citation Edwards, WBFields, CGAnderson, CJPajeau, TSWelch, MJFields, GB Generally applicable, convenient solid-phase synthesis and receptor affinities of octreotide analogs. J Med Chem37:3749-57 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor 1B
Name:Melatonin receptor 1B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40205.08
Organism:Rattus norvegicus
Description:ChEMBL_104938
Residue:364
Sequence:
MPDNSSIANCCAASGLAARPSWPGSAEAEPPETPRAPWVAPMLSTVVIVTTAVDFVGNLL
VILSVLRNRKLRNAGNLFVVNLALADLVVALYPYPLILVAILHDGWVLGEIHCKASAFVM
GLSVIGSVFNITAIAINRYWCICHSATYHRACSQWHAPLYISLIWLLTLVALVPNFFVGS
LEYDPRIYSCTFIQTASTQYTMAVVAIHFLLPIAVVSFCYLRIWILVLQARRKAKAERKL
RLRPSDLRSFLTMFAVFVVFAICWAPLNCIGLAVAINPEAMALQIPEGLFVTSYFLAYFN
SCLNAIVYGLLNQNFRREYKRILSALWSTGRCFHDASKCHLTEDLQGPVPPAAMATIPVQ
EGAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50470044
NameBDBM50470044
Synonyms:CHEMBL437814
TypeSmall organic molecule
Emp. Form.C63H89N13O19S2
Mol. Mass.1396.586
SMILESC[C@H](O)[C@H](CO)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)[C@H](CCCCN)NC(=O)[C@@H](Cc1c[nH]c2ccccc12)NC(=O)[C@H](Cc1ccccc1)NC(=O)[C@H](CS)NC(=O)[C@@H](Cc1ccccc1)NC(=O)CN(CCN(CCN(CC(O)=O)CC(O)=O)CC(O)=O)CC(O)=O)[C@@H](C)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a