Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSimian sarcoma virus Pol protein
LigandBDBM50027124
Substrate/Competitorn/a
Meas. Tech.ChEBML_196792
IC50 0.000007±n/a nM
Citation Wu, RSWolpert-DeFilippes, MKQuinn, FR Quantitative structure--activity correlations of rifamycins as inhibitors of viral RNA-directed DNA polymerase and mammalian alpha and beta DNA polymerases. J Med Chem23:256-61 (1980) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Simian sarcoma virus Pol protein
Name:Simian sarcoma virus Pol protein
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:32733.90
Organism:Woolly monkey sarcoma virus
Description:ChEMBL_196792
Residue:294
Sequence:
MGQNNSTPLSLTLDHWKDVRTRAHNLSVKIRKGKWQTFCSSEWPTFGVGWPPEGTFNLSV
IFAVKRIVFQETGGHPDQVPYIVVWQDLAQSPPPWVPPSAKIAVVSSPENTRGPSAGRPS
APPRPPIYPATDDLLLLSEPPPYPAALPPPLAPPAVGPAPGQAPDSSDPEGPAAGTRSRR
ARSPADDSGPDSTVILPLRAIGPPAEPNGLVPLQYWPFSSADLYNWKSNHPSFSENPAGL
TGLLESLMFSHQPTWDDCQQLLQILFTTEERERILLEARKNVLGDNGAPTQLENLINEAF
PLNRPQWDYNTAAGRERLLVYRRTLVAGLKGAARRPTNLAKVREVLQGPAEPPSVFLERL
MEAYRRYTPFDPSEEGQQAAVAMAFIGQSAPDIKKKLQRLEGLQDYSLQDLVREAEKVYH
KRETEEERQEREKKEAEERERRRDRRQEKNLTRILAAVVSERGSRDRQTGNLSNRARKTP
RDGRPPLDKDQCAYCKEKGHWARECPQKKNVREAKVLALDDQGSRGSDPLPEPRVTLTVE
GTPIEFLVDTGAEHSVLTQPMGKVGSRRTVVEGATGSKVYPWTTKRLLKIGHKQVTHSFL
VIPECPAPLLGRDLLTKLKAQIQFSAEGPQVTWEDRPTMCLVLNLEEEYRLHEKPVPSSI
DPSWLQLFPTVWAERAGMGLANQVPPVVVELRSGASPVAVRQYPMSKEAREGIRPHIQRF
LDLGVLVPCQSPWNTPLLPVKKPGTNDYRPVQDLREINKRVQDIHPTVPNPYNLLSSLPP
SHTWYSVLDLKDAFFCLKLHPNSQPLFAFEWRDPEKGNTGQLTWTRLPQGFKNSPTLFDE
ALHRDLAPFRALNPQVVLLQYVDDLLVAAPTYRDCKEGTQKLLQELSKLGYRVSAKKAQL
CQKEVTYLGYLLKEGKRWLTPARKATVMKIPPPTTPRQVREFLGTAGFCRLWIPGFASLA
APLYPLTKESIPFIWTEEHQKAFDRIKEALLSAPALALPDLTKPFTLYVDERAGVARGVL
TQTLGPWRRPVAYLSKKLDPVASGWPTCLKAVAAVALLLKDADKLTLGQNVTVIASHSLE
SIVRQPPDRWMTNARMTHYQSLLLNERVSFAPPAVLNPATLLPVESEATPVHRCSEILAE
ETGTRRDLKDQPLPGVPAWYTDGSSFIAEGKRRAGAAIVDGKRTVWASSLPEGTSAQKAE
LVALTQALRLAEGKDINIYTDSRYAFATAHIHGAIYKQRGLLTSAGKDIKNKEEILALLE
AIHLPKRVAIIHCPGHQKGNDPVATGNRRADEAAKQAALSTRVLAETTKPQELIPAQVKT
RPGELTPDRGKEFIQRLHQLTHLGPEKLLQLVNRTSLLIPNLQSAVREVTSQCQACAMTN
AVTTYRETGKRQRGDRPGVYWEVDFTEVKPGRYGNRYLLVFIDTFSGWVEAFPTKTETAL
TVCKKILEEILPRFGIPKVLGSDNGPAFVAQVSQGLATQLGINWKLHCAYRPQSSGQVER
MNRTIKETLTKLALETGKDWVALLPLALLRARNTPGRFGLTPYEILYGGPPPILESGGTL
GPDDNFLPVLFTHLKALEVVRTQIWDQIKEVYKPGTVAIPHPFQVGDQVLVRRHRPGSLE
PRWKGPYLVLLTTPTAVKVDGIAAWVHASHLKPAPPSAPDESWELEKADHPLKLRIRRRR
NESAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027124
NameBDBM50027124
Synonyms:2,15,17,29-tetrahydroxy-11-methoxy-3,7,12,14,16,18,22-heptamethyl-26-(Azacycloundec-1-yl)-methylene-amino-6,23-dioxo-8,30-dioxa-24-azatetracyclo[23.3.1.14,7.05,28]triaconta-1(28),2,4,9,19,21,25(29),26-octaen-13-yl acetate | CHEMBL312900
TypeSmall organic molecule
Emp. Form.C48H67N3O11
Mol. Mass.862.0591
SMILESCOC1\C=C\OC2(C)Oc3c(C2=O)c2cc(\C=N\N4CCCCCCCCCC4)c(NC(=O)\C(C)=C/C=C/C(C)C(O)C(C)C(O)C(C)C(OC(C)=O)C1C)c(O)c2c(O)c3C |c:36,t:3,38|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a