Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA polymerase beta
LigandBDBM50027122
Substrate/Competitorn/a
Meas. Tech.ChEBML_50773
IC50 0.001100±n/a nM
Citation Wu, RSWolpert-DeFilippes, MKQuinn, FR Quantitative structure--activity correlations of rifamycins as inhibitors of viral RNA-directed DNA polymerase and mammalian alpha and beta DNA polymerases. J Med Chem23:256-61 (1980) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA polymerase beta
Name:DNA polymerase beta
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:38297.87
Organism:Mus musculus
Description:ChEMBL_50773
Residue:335
Sequence:
MSKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAK
KLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVTGIGPSAARKFVDEGIK
TLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEIKKVDSEYIATVCGS
FRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVHFITDTLSKGETKFMGVCQ
LPSEKDGKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRP
LGVTGVAGEPLPVDSEQDIFDYIQWRYREPKDRSE
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50027122
NameBDBM50027122
Synonyms:2,15,17,29-tetrahydroxy-11-methoxy-3,7,12,14,16,18,22-heptamethyl-6,23-dioxo-8,30-dioxa-24-azatetracyclo[23.3.1.14,7.05,28]triaconta-1(28),2,4,9,19,21,25(29),26-octaen-13-yl acetate | CHEMBL310660
TypeSmall organic molecule
Emp. Form.C37H47NO11
Mol. Mass.681.7692
SMILESCOC1\C=C\OC2(C)Oc3c(C2=O)c2ccc(NC(=O)\C(C)=C/C=C/C(C)C(O)C(C)C(O)C(C)C(OC(C)=O)C1C)c(O)c2c(O)c3C |c:22,t:3,24|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a