Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein kinase C (PKC)
LigandBDBM50478562
Substrate/Competitorn/a
Meas. Tech.ChEMBL_486812
Ki 500±n/a nM
Citation Sun, HHWhite, CBDedinas, JCooper, RSedlock, DM Methylpendolmycin, an indolactam from a Nocardiopsis sp. J Nat Prod54:1440-3[PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein kinase C (PKC)
Name:Protein kinase C (PKC)
Synonyms:Pkcz | Prkcz | Protein kinase C zeta type | nPKC-zeta
Type:PROTEIN
Mol. Mass.:67722.31
Organism:Rattus norvegicus
Description:ChEMBL_104731
Residue:592
Sequence:
MPSRTDPKMDRSGGRVRLKAHYGGDILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKW
VDSEGDPCTVSSQMELEEAFRLACQGRDEVLIIHVFPSIPEQPGMPCPGEDKSIYRRGAR
RWRKLYRANGHLFQAKRFNRRAYCGQCSERIWGLARQGYRCINCKLLVHKRCHVLVPLTC
RRHMDSVMPSQEPPVDDKNDGVDLPSEETDGIAYISSSRKHDNIKDDSEDLKPVIDGVDG
IKISQGLGLQDFDLIRVIGRGSYAKVLLVRLKKNDQIYAMKVVKKELVHDDEDIDWVQTE
KHVFEQASSNPFLVGLHSCFQTTSRLFLVIEYVNGGDLMFHMQRQRKLPEEHARFYAAEI
CIALNFLHERGIIYRDLKLDNVLLDADGHIKLTDYGMCKEGLGPGDTTSTFCGTPNYIAP
EILRGEEYGFSVDWWALGVLMFEMMAGRSPFDIITDNPDMNTEDYLFQVILEKPIRIPRF
LSVKASHVLKGFLNKDPKERLGCRPQTGFSDIKSHAFFRSIDWDLLEKKQTLPPFQPQIT
DDYGLDNFDTQFTSEPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSAEESV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50478562
NameBDBM50478562
Synonyms:CHEMBL502491
TypeSmall organic molecule
Emp. Form.C37H58O8
Mol. Mass.630.8516
SMILES[H][C@]12[C@]3([H])C=C(CO)C[C@]4(OC)C(=O)C(C)=C[C@@]4([H])[C@@]3(O)[C@H](C)[C@@H](OC(=O)CCCCCCCCCCCCC)[C@@]1(OC(C)=O)C2(C)C |r,c:15,t:4|
Structure
n/a