Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase III
LigandBDBM50028342
Substrate/Competitorn/a
Meas. Tech.ChEBML_54508
Ki 930.0±n/a nM
Citation Wright, GEBrown, NC Inhibitors of Bacillus subtilis DNA polymerase III. 6-Anilinouracils and 6-(alkylamino)uracils. J Med Chem23:34-8 (1980) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase III
Name:DNA topoisomerase III
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:81515.22
Organism:Bacillus subtilis
Description:ChEMBL_54525
Residue:727
Sequence:
MSKTVVLAEKPSVGRDLARVLKCHKKGNGYLEGDQYIVTWALGHLVTLADPEGYGKEFQS
WRLEDLPIIPEPLKLVVIKKTGKQFNAVKSQLTRKDVNQIVIATDAGREGELVARWIIEK
ANVRKPIKRLWISSVTDKAIKEGFQKLRSGKEYENLYHSAVARAEADWIVGINATRALTT
KFNAQLSCGRVQTPTLAMIAKREADIQAFTPVPYYGIRAAVDGMTLTWQDKKSKQTRTFN
QDVTSRLLKNLQGKQAVVAELKKTAKKSFAPALYDLTELQRDAHKRFGFSAKETLSVLQK
LYEQHKLVTYPRTDSRFLSSDIVPTLKDRLEGMEVKPYAQYVSQIKKRGIKSHKGYVNDA
KVSDHHAIIPTEEPLVLSSLSDKERKLYDLIAKRFLAVLMPAFEYEETKVIAEIGGETFT
AKGKTVQSQGWKAVYDMAEEDDEQEDDRDQTLPALQKGDTLAVRTLTETSGQTKPPARFN
EGTLLSAMENPSAFMQGEEKGLVKTLGETGGLGTVATRADIIEKLFNSFLIEKKGQDIFI
TSKGKQLLQLVPEDLKSPALTAEWEQKLSAIAAGKLKSAVFIKDMKAYAHQTVKEIKNSS
QTFRHDNITGTACPECGKMMLKVNGKRGTMLVCQDRECGSRKTIARKTNARCPNCHKRME
LRGQGEGQTFACVCGHREKLSVFEKRKNKDKARATKRDVSSYMKKQNKDEPINNALAEQL
KKLGLDK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50028342
NameBDBM50028342
Synonyms:6-(3,4-Dichloro-phenylamino)-1H-pyrimidine-2,4-dione | CHEMBL52034
TypeSmall organic molecule
Emp. Form.C10H7Cl2N3O2
Mol. Mass.272.087
SMILESClc1ccc(Nc2cc(=O)[nH]c(=O)[nH]2)cc1Cl
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a