Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target(E)-1-hydroxy-2-methyl-but-2-enyl 4-diphosphate reductase (IspH)
LigandBDBM50373099
Substrate/Competitorn/a
Meas. Tech.ChEMBL_908690
IC50>1000000±n/a nM
Citation Wang, KWang, WNo, JHZhang, YZhang, YOldfield, E Inhibition of the Fe(4)S(4)-cluster-containing protein IspH (LytB): electron paramagnetic resonance, metallacycles, and mechanisms. J Am Chem Soc132:6719-27 (2010) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
(E)-1-hydroxy-2-methyl-but-2-enyl 4-diphosphate reductase (IspH)
Name:(E)-1-hydroxy-2-methyl-but-2-enyl 4-diphosphate reductase (IspH)
Synonyms:LytB
Type:Enzyme
Mol. Mass.:32103.05
Organism:Aquifex aeolicus
Description:O67625
Residue:289
Sequence:
MVDIIIAEHAGFCFGVKRAVKLAEESLKESQGKVYTLGPIIHNPQEVNRLKNLGVFPSQG
EEFKEGDTVIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVG
EKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKEVVGEIA
LWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYH
IETAEELQPEWFRGVKRVGISAGASTPDWIIEQVKSRIQEICEGQLVSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50373099
NameBDBM50373099
Synonyms:CHEMBL99553 | NE-10575
TypeSmall organic molecule
Emp. Form.C8H14NO7P2
Mol. Mass.298.1462
SMILESC[n+]1cccc(CC(O)(P(O)(O)=O)P(O)(O)=O)c1
Structure
n/a