Target
Retinoic acid receptor gamma
Ligand
BDBM50032221
Substrate
n/a
Meas. Tech.
ChEMBL_195987
EC50
152±n/a nM
Citation
 Beard, RLChandraratna, RAColon, DFGillett, SJHenry, EMarler, DKSong, TDenys, LGarst, MEArefieg, T Synthesis and structure-activity relationships of stilbene retinoid analogs substituted with heteroaromatic carboxylic acids. J Med Chem 38:2820-9 (1995) [PubMed]  Article
Target
Name:
Retinoic acid receptor gamma
Synonyms:
Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor RXR-alpha/gamma | Retinoic acid receptor gamma | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50345.43
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1458016
Residue:
454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
  
Inhibitor
Name:
BDBM50032221
Synonyms:
4-[(E)-2-(3,5,5,8,8-Pentamethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-propenyl]-benzoic acid | CHEMBL32505
Type:
Small organic molecule
Emp. Form.:
C25H30O2
Mol. Mass.:
362.5045
SMILES:
C\C(=C/c1ccc(cc1)C(O)=O)c1cc2c(cc1C)C(C)(C)CCC2(C)C
Structure:
Search PDB for entries with ligand similarity: