Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase I (Topo I)
LigandBDBM50033784
Substrate/Competitorn/a
Meas. Tech.ChEMBL_53720
IC50 24100±n/a nM
Citation Lackey, KBesterman, JMFletcher, WLeitner, PMorton, BSternbach, DD Rigid analogs of camptothecin as DNA topoisomerase I inhibitors. J Med Chem38:906-11 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase I (Topo I)
Name:DNA topoisomerase I
Synonyms:DNA topoisomerase I
Type:Enzyme
Mol. Mass.:90771.02
Organism:Homo sapiens (Human)
Description:P11387
Residue:765
Sequence:
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK
HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP
EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD
KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF
YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL
FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY
FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK
VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD
ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK
LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50033784
NameBDBM50033784
Synonyms:8-ethyl-8-hydroxy-9,12-dioxo-2,3,8,9,12,14-hexahydro-11H-[1,4]dioxino[2,3-g]pyrano[3',4':6,7]indolizino[1,2-b]quinoline-15-carboxylic acid | CHEMBL422922
TypeSmall organic molecule
Emp. Form.C23H18N2O8
Mol. Mass.450.3976
SMILESCCC1(O)C(=O)OCc2c1cc1-c3nc4cc5OCCOc5cc4c(C(O)=O)c3Cn1c2=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a