Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50036286
Substrate/Competitorn/a
Meas. Tech.ChEMBL_807
EC50 55±n/a nM
Citation Hedberg, MHJohansson, AMNordvall, GYliniemelä, ALi, HBMartin, ARHjorth, SUnelius, LSundell, SHacksell, U (R)-11-hydroxy- and (R)-11-hydroxy-10-methylaporphine: synthesis, pharmacology, and modeling of D2A and 5-HT1A receptor interactions. J Med Chem38:647-58 (1995) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50036286
NameBDBM50036286
Synonyms:(R)-(-)-10-methyl-11-hydroxyaporphine | (R)-6,10-dimethyl-5,6,6a,7-tetrahydro-4H-dibenzo[de,g]quinolin-11-ol | CHEMBL53510
TypeSmall organic molecule
Emp. Form.C18H19NO
Mol. Mass.265.3496
SMILESCN1CCc2cccc-3c2[C@H]1Cc1ccc(C)c(O)c-31
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a