Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLeukocyte elastase
LigandBDBM50291935
Substrate/Competitorn/a
Meas. Tech.ChEMBL_64660
KON 7 M-1s-1
Citation Alpegiani, MBissolino, PCorigli, RDel Nero, SPerrone, ERizzo, VSacchi, NCassinelli, GFranceschi, GBaici, A Cephem sulfones as inactivators of human leukocyte elastase. 5. 7 alpha-Methoxy- and 7 alpha-chloro-1,1-dioxocephem 4-ketones. J Med Chem37:4003-19 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Leukocyte elastase
Name:Leukocyte elastase
Synonyms:Bone marrow serine protease | Chymotrypsin | Coagulation factor X | Elastase | Elastase-2 | HLE | Human leukocyte elastase | Leukocyte elastase (HLE) | Medullasin | Neutrophil elastase | Neutrophil elastase (HNE) | Neutrophil elastase (NE) | PMN elastase | Thrombin | Trypsin
Type:Enzyme
Mol. Mass.:28532.38
Organism:Homo sapiens (Human)
Description:P08246
Residue:267
Sequence:
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50291935
NameBDBM50291935
Synonyms:4-(6-Hydroxy-2-methyl-5-oxo-2,5-dihydro-[1,2,4]triazin-3-ylsulfanylmethyl)-benzoic acid (4S,7S)-2-(2,2-dimethyl-propionyl)-7-methoxy-3-methyl-5,5,8-trioxo-5lambda*6*-thia-1-aza-bicyclo[4.2.0]oct-2-en-4-yl ester | CHEMBL422261
TypeSmall organic molecule
Emp. Form.C25H28N4O9S2
Mol. Mass.592.641
SMILESCO[C@@H]1C2N(C1=O)C(C(=O)C(C)(C)C)=C(C)[C@@H](OC(=O)c1ccc(CSc3nc(=O)c(=O)[nH]n3C)cc1)S2(=O)=O |t:14|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a