Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCalpain 2
LigandBDBM50039994
Substrate/Competitorn/a
Meas. Tech.ChEMBL_43845
Ki 50±n/a nM
Citation Harbeson, SLAbelleira, SMAkiyama, ABarrett, RCarroll, RMStraub, JATkacz, JNWu, CMusso, GF Stereospecific synthesis of peptidyl alpha-keto amides as inhibitors of calpain. J Med Chem37:2918-29 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Calpain 2
Name:Calpain 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:79905.09
Organism:Bos taurus
Description:ChEMBL_43846
Residue:700
Sequence:
MAGIAAKLAKDREAAEGLGSHERAVKYLNQDYAALRDECLEAGALFQDPSFPALPSSLGF
KELGPYSSKTRGIEWKRPTEICDNPQFITGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKAPPNLFRIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESRGSLQKLIRIRNPWGEVEWTGQWNDN
CPNWNTVDPEVRETLTRQHEDGEFWMSFNDFLRHYSRLEICNLTPDTLTSDSYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDQEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELTGQTNIHLSKKFFLTTRARERSDTFINLREVLNRFKLPPG
EYIVVPSTFEPNKDGDFCIRVFSEKKADYQVVDDEIEANIDEIDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDDLIIDFD
NFVRCLIRLETLFRIFKQLDPENTGMIQLDLISWLSFSVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50039994
NameBDBM50039994
Synonyms:CHEMBL419898 | [(S)-1-(1-Ethylcarbamoyl-butylcarbamoyl)-3-methyl-butyl]-carbamic acid benzyl ester
TypeSmall organic molecule
Emp. Form.C21H33N3O4
Mol. Mass.391.5044
SMILESCCCC(NC(=O)[C@H](CC(C)C)NC(=O)OCc1ccccc1)C(=O)NCC
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a