Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor
LigandBDBM85330
Substrate/Competitorn/a
Meas. Tech.ChEMBL_207481
Ki>10000±n/a nM
Citation van Wijngaarden, IHamminga, Dvan Hes, RStandaar, PJTipker, JTulp, MTMol, FOlivier, Bde Jonge, A Development of high-affinity 5-HT3 receptor antagonists. Structure-affinity relationships of novel 1,7-annelated indole derivatives. J Med Chem36:3693-9 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor
Name:Thyrotropin-releasing hormone receptor
Synonyms:TRH-R | Thyroliberin receptor
Type:PROTEIN
Mol. Mass.:46618.79
Organism:Rattus norvegicus
Description:ChEMBL_303571
Residue:412
Sequence:
MENETVSELNQTELPPQVAVALEYQVVTILLVVVICGLGIVGNIMVVLVVMRTKHMRTAT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVMPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNKNMNLNTTNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELDDITVTDTYVSTTKVSFDDTCLASEKNGPSSCTYGYSLTAKQEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM85330
NameBDBM85330
Synonyms:CAS_68647 | NSC_68647 | ONDANSETRON | Ondansetron hydrochloride
TypeSmall organic molecule
Emp. Form.C18H19N3O
Mol. Mass.293.363
SMILESCc1nccn1CC1CCc2c(C1=O)c1ccccc1n2C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a