Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetInterleukin-6 receptor alpha chain
LigandBDBM50231569
Substrate/Competitorn/a
Meas. Tech.ChEMBL_218510
Ki>10000±n/a nM
Citation van Wijngaarden, IHamminga, Dvan Hes, RStandaar, PJTipker, JTulp, MTMol, FOlivier, Bde Jonge, A Development of high-affinity 5-HT3 receptor antagonists. Structure-affinity relationships of novel 1,7-annelated indole derivatives. J Med Chem36:3693-9 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Interleukin-6 receptor alpha chain
Name:Interleukin-6 receptor alpha chain
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:50182.76
Organism:Rattus norvegicus
Description:ChEMBL_218510
Residue:460
Sequence:
MLAVGCTLLVALLAAPAVALVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHW
VYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRK
NPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEG
DKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGPRWLKVSWQDPESW
DPSYYLLQFELRYRPVWSKFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQWSK
WSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQGSSPIP
LPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPLKPTFLLVPLL
TPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50231569
NameBDBM50231569
Synonyms:CILANSETRON | Cilansetron | KC-9946
TypeSmall organic molecule
Emp. Form.C20H21N3O
Mol. Mass.319.4002
SMILESCc1nccn1C[C@H]1CCc2c(C1=O)c1cccc3CCCn2c13
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a