Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLTB4R
LigandBDBM50029482
Substrate/Competitorn/a
Meas. Tech.ChEMBL_99495
Ki 1.2±n/a nM
Citation Sawyer, JSBaldwin, RFSofia, MJFloreancig, PMarder, PSaussy, DLFroelich, LLSilbaugh, SAStengel, PWCockerham, SL Biphenylyl-substituted xanthones: highly potent leukotriene B4 receptor antagonists. J Med Chem36:3982-4 (1994) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
LTB4R
Name:LTB4R
Synonyms:Chemoattractant receptor-like 1 | G-protein coupled receptor 16 | LTB4-R 1 | Leukotriene B4 R1 | Leukotriene B4 receptor | Leukotriene B4 receptor 1 | P2Y purinoceptor 7 | P2Y7
Type:Enzyme Catalytic Domain
Mol. Mass.:37582.68
Organism:HUMAN
Description:Leukotriene B4 R1 LTB4R HUMAN::Q15722
Residue:352
Sequence:
MNTTSSAAPPSLGVEFISLLAIILLSVALAVGLPGNSFVVWSILKRMQKRSVTALMVLNL
ALADLAVLLTAPFFLHFLAQGTWSFGLAGCRLCHYVCGVSMYASVLLITAMSLDRSLAVA
RPFVSQKLRTKAMARRVLAGIWVLSFLLATPVLAYRTVVPWKTNMSLCFPRYPSEGHRAF
HLIFEAVTGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILTFAAFWLPYHVV
NLAEAGRALAGQAAGLGLVGKRLSLARNVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VAKLLEGTGSEASSTRRGGSLGQTARSGPAALEPGPSESLTASSPLKLNELN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50029482
NameBDBM50029482
Synonyms:6-[3-(4-Acetyl-2-ethyl-5-hydroxy-phenoxy)-propoxy]-5-(2-carboxy-ethyl)-9-oxo-9H-xanthene-2-carboxylic acid | CHEMBL88337 | LY-282210
TypeSmall organic molecule
Emp. Form.C30H28O10
Mol. Mass.548.5373
SMILESCCc1cc(C(C)=O)c(O)cc1OCCCOc1ccc2c(oc3ccc(cc3c2=O)C(O)=O)c1CCC(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a