Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenosine receptor A1
LigandBDBM50043215
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29299
Ki 164.3±n/a nM
Citation Peet, NPLentz, NLDudley, MWOgden, AMMcCarty, DRRacke, MM Xanthines with C8 chiral substituents as potent and selective adenosine A1 antagonists. J Med Chem36:4015-20 (1994) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenosine receptor A1
Name:Adenosine receptor
Synonyms:ADENOSINE A1 | ADENOSINE A1 high | ADENOSINE A1 low | Adenosine A1 receptor (A1) | Adenosine receptors A1
Type:Protein
Mol. Mass.:36704.13
Organism:Rattus norvegicus (rat)
Description:n/a
Residue:326
Sequence:
MPPYISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
QRRAAVAIAGCWILSLVVGLTPMFGWNNLSVVEQDWRANGSVGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPTCQKPSILIYIAIFLTHGNSAMNPIVYAFRIHKFRVTFL
KIWNDHFRCQPKPPIDEDLPEEKAED
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50043215
NameBDBM50043215
Synonyms:8-(2-Phenyl-cyclopentyl)-1,3-dipropyl-3,9-dihydro-purine-2,6-dione | CHEMBL2367993
TypeSmall organic molecule
Emp. Form.C22H28N4O2
Mol. Mass.380.4833
SMILESCCCn1c2[nH]c(nc2c(=O)n(CCC)c1=O)[C@H]1CCC[C@@H]1c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a