Target
Retinoic acid receptor gamma
Ligand
BDBM50044099
Substrate
n/a
Meas. Tech.
ChEMBL_196665
EC50
23±n/a nM
Citation
 Boehm, MFMcClurg, MRPathirana, CMangelsdorf, DWhite, SKHebert, JWinn, DGoldman, MEHeyman, RA Synthesis of high specific activity [3H]-9-cis-retinoic acid and its application for identifying retinoids with unusual binding properties. J Med Chem 37:408-14 (1994) [PubMed]  Article
Target
Name:
Retinoic acid receptor gamma
Synonyms:
Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor RXR-alpha/gamma | Retinoic acid receptor gamma | Retinoid receptor
Type:
PROTEIN
Mol. Mass.:
50345.43
Organism:
Homo sapiens (Human)
Description:
ChEMBL_1458016
Residue:
454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
  
Inhibitor
Name:
BDBM50044099
Synonyms:
4-[(E)-2-(3-Ethyl-5,5,8,8-tetramethyl-5,6,7,8-tetrahydro-naphthalen-2-yl)-propenyl]-benzoic acid | CHEMBL284937
Type:
Small organic molecule
Emp. Form.:
C26H32O2
Mol. Mass.:
376.5311
SMILES:
CCc1cc2c(cc1\C(C)=C\c1ccc(cc1)C(O)=O)C(C)(C)CCC2(C)C
Structure:
Search PDB for entries with ligand similarity: