Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-Deoxy-D-xylulose-5-phosphate synthase (DXP synthase))
LigandBDBM50496738
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1331618
Ki 5600±n/a nM
Citation Smith, JMVierling, RJMeyers, CF Selective inhibition of E. coli 1-deoxy-D-xylulose-5-phosphate synthase by acetylphosphonates(). Medchemcomm3:65-67 (2012) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
1-Deoxy-D-xylulose-5-phosphate synthase (DXP synthase))
Name:1-Deoxy-D-xylulose-5-phosphate synthase (DXP synthase))
Synonyms:n/a
Type:Protein
Mol. Mass.:67617.17
Organism:Escherichia coli K-12 (Enterobacteria)
Description:n/a
Residue:620
Sequence:
MSFDIAKYPTLALVDSTQELRLLPKESLPKLCDELRRYLLDSVSRSSGHFASGLGTVELT
VALHYVYNTPFDQLIWDVGHQAYPHKILTGRRDKIGTIRQKGGLHPFPWRGESEYDVLSV
GHSSTSISAGIGIAVAAEKEGKNRRTVCVIGDGAITAGMAFEAMNHAGDIRPDMLVILND
NEMSISENVGALNNHLAQLLSGKLYSSLREGGKKVFSGVPPIKELLKRTEEHIKGMVVPG
TLFEELGFNYIGPVDGHDVLGLITTLKNMRDLKGPQFLHIMTKKGRGYEPAEKDPITFHA
VPKFDPSSGCLPKSSGGLPSYSKIFGDWLCETAAKDNKLMAITPAMREGSGMVEFSRKFP
DRYFDVAIAEQHAVTFAAGLAIGGYKPIVAIYSTFLQRAYDQVLHDVAIQKLPVLFAIDR
AGIVGADGQTHQGAFDLSYLRCIPEMVIMTPSDENECRQMLYTGYHYNDGPSAVRYPRGN
AVGVELTPLEKLPIGKGIVKRRGEKLAILNFGTLMPEAAKVAESLNATLVDMRFVKPLDE
ALILEMAASHEALVTVEENAIMGGAGSGVNEVLMAHRKPVPVLNIGLPDFFIPQGTQEEM
RAELGLDAAGMEAKIKAWLA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50496738
NameBDBM50496738
Synonyms:CHEMBL3220785
TypeSmall organic molecule
Emp. Form.C6H12LiO4P
Mol. Mass.186.072
SMILES[Li;v0+].[#6]-[#6]-[#6]-[#6]-[#8]P([#8-])(=O)[#6](-[#6])=O
Structure
n/a