Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlcohol dehydrogenase S chain
LigandBDBM50390969
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1355376
Kd 200±n/a nM
Citation Fries, RWBohlken, DPPlapp, BV 3-Substituted pyrazole derivatives as inhibitors and inactivators of liver alcohol dehydrogenase. J Med Chem22:356-9 (1979) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Alcohol dehydrogenase S chain
Name:Alcohol dehydrogenase S chain
Synonyms:1.1.1.1 | Alcohol dehydrogenase S chain
Type:PROTEIN
Mol. Mass.:39633.49
Organism:Equus caballus
Description:ChEMBL_105061
Residue:374
Sequence:
MSTAGKVIKCKAAVLWEQKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDDHVVSGTLVA
PLPVIAGHEAAGIVESIGEGVTTVRPGDKVIPLFIPQCGKCSVCKHPEGNLCLKNLSMPR
GTMQDGTSRFTCRGKPIHHFLGTSTFSQYTVVDEISVAKIDAASPLEKVCLVGCGFSTGY
GSAVKVAKVTQGSTCAVFGLGGVGLSVIMGCKAAGAARIIGVDINKDKFAKAKEVGATEC
VNPQDYKKPIQEVLTEMSNGGVDFSFEVIGRLDTMVAALSCCQEAYGVSVIVGVPPDSQN
LSMNPMLLLSGRTWKGAIFGGFKSKDSVPKLVADFMAKKFALDPLITHVLPFEKINEGFD
LLRSGKSIRTILTF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50390969
NameBDBM50390969
Synonyms:PYRAZOLE
TypeSmall organic molecule
Emp. Form.C3H4N2
Mol. Mass.68.0773
SMILESc1cn[nH]c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a