Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid receptor
LigandBDBM50048298
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196012
Ki 860±n/a nM
Citation Charpentier, BBernardon, JMEustache, JMillois, CMartin, BMichel, SShroot, B Synthesis, structure-affinity relationships, and biological activities of ligands binding to retinoic acid receptor subtypes. J Med Chem38:4993-5006 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid receptor
Name:Retinoic acid receptor RXR-alpha/gamma
Synonyms:Nuclear receptor subfamily 1 group B member 3 | RAR-gamma | Retinoic acid receptor gamma
Type:PROTEIN
Mol. Mass.:50345.43
Organism:Homo sapiens (Human)
Description:ChEMBL_1458016
Residue:454
Sequence:
MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50048298
NameBDBM50048298
Synonyms:6-(4,4-Dimethyl-chroman-6-yl)-naphthalene-2-carboxylic acid | CHEMBL342051
TypeSmall organic molecule
Emp. Form.C22H20O3
Mol. Mass.332.3924
SMILESCC1(C)CCOc2ccc(cc12)-c1ccc2cc(ccc2c1)C(O)=O
Structure
n/a