Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate cyclase type V
LigandBDBM50009864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31438
EC50 370±n/a nM
Citation Yamada, KRice, KCFlippen-Anderson, JLEissenstat, MAWard, SJJohnson, MRHowlett, AC (Aminoalkyl)indole isothiocyanates as potential electrophilic affinity ligands for the brain cannabinoid receptor. J Med Chem39:1967-74 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenylate cyclase type V
Name:Adenylate cyclase type V
Synonyms:ATP pyrophosphate-lyase 5 | Adenylate cyclase type 5 | Adenylate cyclase type IX | Adenylyl cyclase 5
Type:PROTEIN
Mol. Mass.:139188.88
Organism:Rattus norvegicus
Description:ChEMBL_31725
Residue:1262
Sequence:
MSGSKSVSPPGYAAQTAASPAPRGGPEHRAAWGEADSRANGYPHAPGGSTRGSTKRSGGA
VTPQQQQRLASRWRGGDDDEDPPLSGDDPLVGGFGFSFRSKSAWQERGGDDGGRGSRRQR
RGAAGGGSTRAPPAGGSGSSAAAAAAAGGTEVRPRSVEVGLEERRGKGRAAEELEPGTGT
VEDGDGSEDGGSSVASGSGTGTVLSLGACCLALLQIFRSKKFPSDKLERLYQRYFFRLNQ
SSLTMLMAVLVLVCLVMLAFHAARPPLQVVYLAVLAAAVGVILIMAVLCNRAAFHQDHMG
LACYALIAVVLAVQVVGLLLPQPRSASEGIWWTVFFIYTIYTLLPVRMRAAVLSGVLLSA
LHLAISLHTNAQDQFLLKQLVSNVLIFSCTNIVGVCTHYPAEVSQRQAFQETRECIQARL
HSQRENQQQERLLLSVLPRHVAMEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFT
SLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVE
MGMDMIEAISSVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGG
KAGRIHITKATLNYLNGDYEVEPGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKM
NRQRTNSIGHNPPHWGAERPFYNHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEF
LGRAIDARSIDRLRSEHVRKFLLTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQ
ITIVPHSLFMLSFYLSCFLLLALVVFISVIYACVKLFPTPLQTLSRKIVRSKKNSTLVGV
FTITLVFLSAFVNMFMCNSKNLVGCLAEEHNITVNQVNACHVMESAFNYSLGDEQGFCGS
PQSNCNFPEYFTYSVLLSLLACSVFLQISCIGKLVLMLAIELIYVLIVEVPGVTLFDNAD
LLVTANAIDFSNNGTSQCPEHATKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWK
LQATEEKEEMEELQAYNRRLLHNILPKDVAAHFLARERRNDELYYQSCECVAVMFASIAN
FSEFYVELEANNEGVECLRLLNEIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDST
YDKAGKTHIKALADFAMKLMDQMKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIW
GNTVNVASRMDSTGVPDRIQVTTDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPP
LS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50009864
NameBDBM50009864
Synonyms:CHEMBL274833 | [2-Methyl-1-(2-morpholin-4-yl-ethyl)-1H-indol-3-yl]-naphthalen-1-yl-methanone
TypeSmall organic molecule
Emp. Form.C26H26N2O2
Mol. Mass.398.4968
SMILESCc1c(C(=O)c2cccc3ccccc23)c2ccccc2n1CCN1CCOCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a