Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAdenylate cyclase
LigandBDBM50052124
Substrate/Competitorn/a
Meas. Tech.ChEMBL_31878
IC50 32±n/a nM
Citation Robbins, JDBoring, DLTang, WJShank, RSeamon, KB Forskolin carbamates: binding and activation studies with type I adenylyl cyclase. J Med Chem39:2745-52 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Adenylate cyclase
Name:Adenylate cyclase
Synonyms:Brain adenylate cyclase 1
Type:PROTEIN
Mol. Mass.:123469.95
Organism:Homo sapiens
Description:ChEMBL_31877
Residue:1119
Sequence:
MAGAPRGGGGGGGGAGEPGGAERAAGTSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTLGANALLFVGVNMYGVFVRILTERSQR
KAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHD
NVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGL
TQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWS
NDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSH
RRKIFPGLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALR
TASEKLRNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQK
YHQLQDEYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRV
QCFPGCLTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLSSGGQRTALP
TLPCESTHHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAV
SGRSYEPIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNL
LPAHVAQHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEI
IADFDELMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFD
VLDEINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQV
TEEVHRLLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRA
GLQGRRPPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50052124
NameBDBM50052124
Synonyms:Acetic acid (3R,4aR,5S,6S,6aS,10S,10aR,10bS)-10,10b-dihydroxy-6-(2-methoxy-ethylcarbamoyloxy)-3,4a,7,7,10a-pentamethyl-1-oxo-3-vinyl-dodecahydro-benzo[f]chromen-5-yl ester | CHEMBL92229
TypeSmall organic molecule
Emp. Form.C26H41NO9
Mol. Mass.511.605
SMILESCOCCNC(=O)O[C@@H]1[C@H](OC(C)=O)[C@@]2(C)O[C@](C)(CC(=O)[C@]2(O)[C@@]2(C)[C@@H](O)CCC(C)(C)[C@H]12)C=C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a