Target
Retinoic acid receptor gamma
Ligand
BDBM31892
Substrate
n/a
Meas. Tech.
ChEMBL_196166
Kd
17±n/a nM
Citation
 Beard, RLColon, DFSong, TKDavies, PJKochhar, DMChandraratna, RA Synthesis and structure-activity relationships of retinoid X receptor selective diaryl sulfide analogs of retinoic acid. J Med Chem 39:3556-63 (1996) [PubMed]  Article
Target
Name:
Retinoic acid receptor gamma
Synonyms:
n/a
Type:
PROTEIN
Mol. Mass.:
50896.02
Organism:
Mus musculus
Description:
ChEMBL_196161
Residue:
458
Sequence:
MATNKERLFAPGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSYELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEALRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPEMFEDDSSKPGPHPKASSEDEAPGGQGKRGQSPQPDQGP
  
Inhibitor
Name:
BDBM31892
Synonyms:
9-cis retinoic acid | 9C-RA | CHEMBL705 | Panretin | alitretinoin
Type:
Small organic molecule
Emp. Form.:
C20H28O2
Mol. Mass.:
300.4351
SMILES:
C\C(\C=C\C1=C(C)CCCC1(C)C)=C\C=C\C(\C)=C\C(O)=O |c:4|
Structure:
Search PDB for entries with ligand similarity: