Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetATP-citrate synthase
LigandBDBM50052980
Substrate/Competitorn/a
Meas. Tech.ChEMBL_29518
Ki 7300±n/a nM
Citation Gribble, ADDolle, REShaw, AMcNair, DNovelli, RNovelli, CESlingsby, BPShah, VPTew, DSaxty, BAAllen, MGroot, PHPearce, NYates, J ATP-citrate lyase as a target for hypolipidemic intervention. Design and synthesis of 2-substituted butanedioic acids as novel, potent inhibitors of the enzyme. J Med Chem39:3569-84 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
ATP-citrate synthase
Name:ATP-citrate synthase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:120645.65
Organism:Rattus norvegicus
Description:ChEMBL_857791
Residue:1100
Sequence:
MSAKAISEQTGKELLYKYICTTSAIQNRFKYARVTPDTDWAHLLQDHPWLLSQSLVVKPD
QLIKRRGKLGLVGVNLSLDGVKSWLKPRLGHEATVGKAKGFLKNFLIEPFVPHSQAEEFY
VCIYATREGDYVLFHHEGGVDVGDVDTKAQKLLVGVDEKLNAEDIKRHLLVHAPEDKKEI
LASFISGLFNFYEDLYFTYLEINPLVVTKDGVYILDLAAKVDATADYICKVKWGDIEFPP
PFGREAYPEEAYIADLDAKSGASLKLTLLNPKGRIWTMVAGGGASVVYSDTICDLGGVNE
LANYGEYSGAPSEQQTYDYAKTILSLMTREKHPDGKILIIGGSIANFTNVAATFKGIVRA
IRDYQGSLKEHEVTIFVRRGGPNYQEGLRVMGEVGKTTGIPIHVFGTETHMTAIVGMAWA
PAIPNQPPTAAHTANFLLNASGSTSTPAPSRTASFSESRADEVAPAKKAKPAMPQDSVPS
PRSLQGKSATLFSRHTKAIVWGMQTRAVQGMLDFDYVCSRDEPSVAAMVYPFTGDHKQKF
YWGHKEILIPVFKNMADAMKKHPEVDVLINFASLRSAYDSTMETMNYAQIRTIAIIAEGI
PEALTRKLIKKADQKGVTIIGPATVGGIKPGCFKIGNTGGMLDNILASKLYRPGSVAYVS
RSGGMSNELNNIISRTTDGVYEGVAIGGDRYPGSTFMDHVLRYQDTPGVKMIVVLGEIGG
TEEYKICRGIKEGRLTKPVVCWCIGTCATMFSSEVQFGHAGACANQASETAVAKNQALKE
AGVFVPRSFDELGEIIQSVYEDLVAKGAIVPAQEVPPPTVPMDYSWARELGLIRKPASFM
TSICDERGQELIYAGMPITEVFKEEMGIGGVLGLLWFQRRLPKYSCQFIEMCLMVTADHG
PAVSGAHNTIICARAGKDLVSSLTSGLLTIGDRFGGALDAAAKMFSKAFDSGIIPMEFVN
KMKKEGKLIMGIGHRVKSINNPDMRVQILKDFVKQHFPATPLLDYALEVEKITTSKKPNL
ILNVDGFIGVAFVDMLRNCGSFTREEADEYVDIGALNGVFVLGRSMGFIGHYLDQKRLKQ
GLYRHPWDDISYVLPEHMSM
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50052980
NameBDBM50052980
Synonyms:2-[6-(2,3-Dichloro-phenyl)-hexylsulfanylmethyl]-2-hydroxy-succinic acid | CHEMBL119690
TypeSmall organic molecule
Emp. Form.C17H22Cl2O5S
Mol. Mass.409.325
SMILESOC(=O)CC(O)(CSCCCCCCc1cccc(Cl)c1Cl)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a