Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetIonotropic glutamate receptor kainate 2/5
LigandBDBM50053063
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90595
Ki 3.5±n/a nM
Citation Cantrell, BEZimmerman, DMMonn, JAKamboj, RKHoo, KHTizzano, JPPullar, IAFarrell, LNBleakman, D Synthesis of a series of aryl kainic acid analogs and evaluation in cells stably expressing the kainate receptor humGluR6. J Med Chem39:3617-24 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Ionotropic glutamate receptor kainate 2/5
Name:Ionotropic glutamate receptor kainate 2/5
Synonyms:Glutamate receptor ionotropic kainate 2
Type:PROTEIN
Mol. Mass.:102478.61
Organism:Rattus norvegicus
Description:ChEMBL_936439
Residue:908
Sequence:
MKIISPVLSNLVFSRSIKVLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053063
NameBDBM50053063
Synonyms:(2S,3S,4S)-3-Carboxymethyl-4-[1-(3-methoxy-phenyl)-vinyl]-pyrrolidine-2-carboxylic acid | CHEMBL332168
TypeSmall organic molecule
Emp. Form.C16H19NO5
Mol. Mass.305.3258
SMILESCOc1cccc(c1)C(=C)[C@H]1CN[C@@H]([C@H]1CC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a