Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlutamate receptor ionotropic, kainate 2
LigandBDBM50053088
Substrate/Competitorn/a
Meas. Tech.ChEMBL_90456
Ki 41.1±n/a nM
Citation Cantrell, BEZimmerman, DMMonn, JAKamboj, RKHoo, KHTizzano, JPPullar, IAFarrell, LNBleakman, D Synthesis of a series of aryl kainic acid analogs and evaluation in cells stably expressing the kainate receptor humGluR6. J Med Chem39:3617-24 (1996) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glutamate receptor ionotropic, kainate 2
Name:Glutamate receptor ionotropic, kainate 2
Synonyms:EAA4 | Excitatory amino acid receptor 4 | GLUR6 | GRIK2 | GluK2 | GluR-6 | Glutamate kainate | Glutamate receptor 6 | Glutamate receptor ionotropic kainate 2 | Glutamate receptor, ionotropic kainate 2 | Glutamate-Kainate | Glutamate-Kainate, GluR6
Type:Enzyme Catalytic Domain
Mol. Mass.:102592.78
Organism:Homo sapiens (Human)
Description:Q13002
Residue:908
Sequence:
MKIIFPILSNPVFRRTVKLLLCLLWIGYSQGTTHVLRFGGIFEYVESGPMGAEELAFRFA
VNTINRNRTLLPNTTLTYDTQKINLYDSFEASKKACDQLSLGVAAIFGPSHSSSANAVQS
ICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWKTVTVVYDDST
GLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILK
QALAMGMMTEYYHYIFTTLDLFALDVEPYRYSGVNMTGFRILNTENTQVSSIIEKWSMER
LQAPPKPDSGLLDGFMTTDAALMYDAVHVVSVAVQQFPQMTVSSLQCNRHKPWRFGTRFM
SLIKEAHWEGLTGRITFNKTNGLRTDFDLDVISLKEEGLEKIGTWDPASGLNMTESQKGK
PANITDSLSNRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEI
RLVEDGKYGAQDDANGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISI
LYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSD
VVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLT
VERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKS
NEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITI
AILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVG
EFLYKSKKNAQLEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRR
LPGKETMA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50053088
NameBDBM50053088
Synonyms:(2S,3S,4S)-3-Carboxymethyl-4-(1-p-tolyl-vinyl)-pyrrolidine-2-carboxylic acid | CHEMBL332334
TypeSmall organic molecule
Emp. Form.C16H19NO4
Mol. Mass.289.3264
SMILESCc1ccc(cc1)C(=C)[C@H]1CN[C@@H]([C@H]1CC(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a