Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin 1B/1D receptor
LigandBDBM50056378
Substrate/Competitorn/a
Meas. Tech.ChEMBL_1778
IC50 700±n/a nM
Citation Modica, MSantagati, MRusso, FParotti, LDe Gioia, LSelvaggini, CSalmona, MMennini, T [[(Arylpiperazinyl)alkyl]thio]thieno[2,3-d]pyrimidinone derivatives as high-affinity, selective 5-HT1A receptor ligands. J Med Chem40:574-85 (1997) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin 1B/1D receptor
Name:Serotonin 1B/1D receptor
Synonyms:5-HT-1B | 5-HT1B | 5-hydroxytryptamine receptor 1B (5HT1B) | Serotonin 1 (5-HT1) receptor | Serotonin receptor 1B
Type:Protein
Mol. Mass.:43173.33
Organism:Rattus norvegicus (Rat)
Description:P28564
Residue:386
Sequence:
MEEQGIQCAPPPPATSQTGVPLANLSHNCSADDYIYQDSIALPWKVLLVALLALITLATT
LSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDF
WLSSDITCCTASIMHLCVIALDRYWAITDAVDYSAKRTPKRAAIMIVLVWVFSISISLPP
FFWRQAKAEEEVLDCFVNTDHVLYTVYSTVGAFYLPTLLLIALYGRIYVEARSRILKQTP
NKTGKRLTRAQLITDSPGSTSSVTSINSRVPEVPSESGSPVYVNQVKVRVSDALLEKKKL
MAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHMAIFDFFNWLGYLNSLI
NPIIYTMSNEDFKQAFHKLIRFKCTG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50056378
NameBDBM50056378
Synonyms:3-Amino-2-{3-[4-(2-methoxy-phenyl)-piperazin-1-yl]-propylsulfanyl}-5,6-dimethyl-3H-thieno[2,3-d]pyrimidin-4-one | CHEMBL12028
TypeSmall organic molecule
Emp. Form.C22H29N5O2S2
Mol. Mass.459.628
SMILESCOc1ccccc1N1CCN(CCCSc2nc3sc(C)c(C)c3c(=O)n2N)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a