Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM50061617
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196643
Ki 2100±n/a nM
Citation Umemiya, HFukasawa, HEbisawa, MEyrolles, LKawachi, EEisenmann, GGronemeyer, HHashimoto, YShudo, KKagechika, H Regulation of retinoidal actions by diazepinylbenzoic acids. Retinoid synergists which activate the RXR-RAR heterodimers. J Med Chem40:4222-34 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoid X receptor gamma/retinoic acid receptor alpha
Synonyms:Nuclear receptor subfamily 2 group B member 3 | Retinoic acid receptor RXR-gamma | Retinoid X receptor gamma
Type:PROTEIN
Mol. Mass.:50878.26
Organism:Homo sapiens (Human)
Description:ChEMBL_197216
Residue:463
Sequence:
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50061617
NameBDBM50061617
Synonyms:4-(7,7,10,10-Tetramethyl-7,8,9,10-tetrahydro-5-oxa-13-aza-benzo[4,5]cyclohepta[1,2-b]naphthalen-12-yl)-benzoic acid | CHEMBL334534
TypeSmall organic molecule
Emp. Form.C28H27NO3
Mol. Mass.425.5189
SMILESCC1(C)CCC(C)(C)c2cc3c(Oc4ccccc4N=C3c3ccc(cc3)C(O)=O)cc12 |c:20|
Structure
n/a