Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoid X receptor gamma/retinoic acid receptor alpha
LigandBDBM31883
Substrate/Competitorn/a
Meas. Tech.ChEMBL_196640
Ki 120±n/a nM
Citation Umemiya, HFukasawa, HEbisawa, MEyrolles, LKawachi, EEisenmann, GGronemeyer, HHashimoto, YShudo, KKagechika, H Regulation of retinoidal actions by diazepinylbenzoic acids. Retinoid synergists which activate the RXR-RAR heterodimers. J Med Chem40:4222-34 (1998) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Retinoid X receptor gamma/retinoic acid receptor alpha
Name:Retinoid X receptor gamma/retinoic acid receptor alpha
Synonyms:Nuclear receptor subfamily 2 group B member 3 | Retinoic acid receptor RXR-gamma | Retinoid X receptor gamma
Type:PROTEIN
Mol. Mass.:50878.26
Organism:Homo sapiens (Human)
Description:ChEMBL_197216
Residue:463
Sequence:
MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31883
NameBDBM31883
Synonyms:9-cis-retinoic acid (9cRA) | ALL-TRANS-RETINOIC ACID | AT-RA | Atralin | CHEMBL38 | MLS000028588 | SMR000058245 | TRETINOIN | Vitamin A acid | [3H]RA | [3H]Retinoic acid | [3H]Vitamin A acid | [3H]tretinoin | all-trans retinoic acid | cid_444795
Typeradiolabeled ligand
Emp. Form.C20H28O2
Mol. Mass.300.4351
SMILESC\C(\C=C\C1=C(C)CCCC1(C)C)=C/C=C/C(/C)=C/C(O)=O |c:4|
Structure
n/a